SEO Analysis of your site


Complete Detailed Analysis

http://www.ytechb.com/

Analyzed on 2017-09-01 11:21:54

About this Analysis


This is a specially targeted analysis of your site http://www.ytechb.com/. It points out the most important aspects in terms of user experience as well as search engine exposure that needs attention to start getting traffic and retained visitors.
We have created our own algorithm to score your site. After reviewing thousands of websites in our algorithm, we have noticed that a site which scores 75 and above must be already receiving search engine traffic with good social exposure. If yoursite is anywhere below 75, you need to start acting immediately to improve your website promotion.

Your website Score

Your website social marketing status

The below stats are for your website http://www.ytechb.com/ and not your facebook or social pages.

Reddit Shares


0

Total Facebook Likes


4

Pinterest Pins


0

Google Plus:


198

Stumble Upon:


0

Linkedin


0

Alexa Rank:


529313


Your website social meter

Search engines have evolved, social status today holds a very important role in search engine ranking. External factors including the social exposure, the number of quality backlinks adds a lot of weightage to rank a website on the search engines.


This pie chart will show you the intensity of popularity over different social media network so that you can concentrate your efforts on the weak areas.

Social Meter:


The Observations


  1. Title

    YTECHB - Mobile Phone News | Apps News | Android Tricks | Reviews

    60% Complete

  2. Keywords



  3. Description

    YTECHB provides the Best Android Tricks, Mobile Phone news, Apps News, Reviews, iOS Tricks in easy way with step by step tutorials.


  4. Keywords in URL

    Excellent, keywords found in your URL


  5. Alt Tags

  6. You have 0 images without alt tags. out of 56 images on the page.
  7.  Excellent

  8. Facebook Likes

    You only have 4 Likes.Your facebook likes needs immediate improvement.


  9. Pinterest Pins

    Pinterest Pins are great way of sharing content, your website is only shared 0 times on pinterest, make your content more shareable, join social combo plan


  10. Google Plus

    Your website has good content with nice google plus count of 198, you are on the right track. If you wish to exedite, join our social combo plan.


  11. Linkedin

    Your website is not shared on Linkedin enough, they are only 0 , It is very crucial for ranking in google, make your content shareable, to speed up, join our social combo.


  12. Alexa Rank

    Your website Alexa Rank needs improvement, Its  529313 , The higher the Alexa Number, the lesser your site popularity.



  13. Body Text: Keyword cloud showing the most and least used keywords on the page.

    Below are the keywords which are prominently used in your webpage. Kindly review them to make sure you are not using unnecessary keywords not relevant to your business.

    This is very useful to get a bird eye on which keywords are most prominently used on your page. So that you are not diluting the keyword density on untargeted keywords.

    ytechb mobile phone news apps android tricks reviews gadgetsnewsmobilemobile trickspccontact usmoreaccessoriesgiveawaysdisclaimerprivacy policyabout search friday september create site find free wordpress themes plugins trending nowmoto launched dual rear camera setupnubia lite announced ramsony xperia sony launches compact snapdragon soclg socintex aqua note nougat jivi volte smartphones starts micromax canvas plex tab inch display intex style iii smartphone moto setup ashutosh singh nubia soc mobileallaccessoriesalcatelappleapps newsasusblackberryblucomiocoolpadfeaturedgioneegiveawaysgooglehtchuaweiifainfinixintexitelkarbonnlavalenovolephonelgm techmafemazemeizumicromaxmobilemobile tricksmotonewsnokianubianuu mobilesoneplusoppooukitelpanasonicpcpolaroidreliancesamsungsonysponsoredswipet mobiletelecomulefoneupcoming phonesvideoconvivovodafonexiaomizenzopoztemore finally unveiled awaited ifa berlin tons leaks ram haneet august officially named today event china telecom airtel broadband plans increased data pricebsnl offers plansbsnl month night callingstay connected fans followers follow subscribers subscribe featured samsung galaxy features knowupdated download oreo pixel launcher apk releasedlist updatelist updatepclava helium notebook specifications price june lava introduced india light stay safe system ransomware attack dangerous powerful cyber affects millions peoples attacks increasing day asus vivobook laptop nanoedge thin bezels recover permanently deleted files july mistakes delete needed don worry transfer computers lan cable days important generally pendrive external hard disk usb special downgrade ios versions march disturbed developers update perfectly running compatibility issues ivoomi big screen size jio summer surprise offer ends april games easy step tutorials contact email protected copyright edit live css savewrite hit save ctrl space auto complete

  14. Keyphrase found on your page.

    Single Keywords


    launched, android, singh, apps, news, xperia, launches, ashutosh, camera, haneet, snapdragon, august, nubia, moto, announced, data, sony, smartphones, lite, june, asus, tricks, notebook, compact, features,

    2 Keywords Phrase


    haneet singh,
    ashutosh singh,
    singh june,
    launches xperia,
    sony launches,
    xperia launched,
    android oreo,
    launched camera,
    compact snapdragon,

    3 Keywords Phrase


    launches xperia compact,
    xperia compact snapdragon,
    xperia launched camera,
    sony launches xperia,
    setup ashutosh singh,
    camera setup ashutosh,
    rear camera setup,
    launched android nougat,
    ashutosh singh september,


  15. OnPage Links

    There are total 205 backlinks found on your page out of which 6 are external links

    There are total 45 links without anchor text

    199 Internal Links

    35% Complete (success)

    6 External Links

    20% Complete (warning)
  16. H1 Tags

    • H1

      YTECHB – Mobile Phone News | Apps News | Android Tricks | Reviews

    • You are using H1 tags effectively Content used in the h1 are relevant to the page

  17. H2 Tags

    • You are not using H2 tags effectively
    • H2 Not Used

  18. H3 Tags

    • H3

      Moto X4 Launched with Dual Rear Camera Setup

    • H3

      Nubia Z17 Lite Announced with 6GB RAM

    • H3

      Sony Xperia XA1 Plus Launched with 23MP Camera for $379

    • H3

      Sony Launches Xperia XZ1 and XZ1 Compact with Snapdragon 835 SoC

    • H3

      LG V30 Launched with Snapdragon 835 SoC

    • H3

      Intex Aqua Note 5.5 Launched with Android Nougat for Rs.5,799

    • H3

      Jivi Launches 5 Android VoLTE Smartphones, Starts at Rs.3,333

    • H3

      Micromax Launches Canvas Plex Tab with 8-inch Display for Rs.12,999

    • H3

      Intex Launches Aqua Style III 4G Smartphone for Rs.4,299

    • H3

      Moto X4 Launched with Dual Rear Camera Setup

    • H3

      Nubia Z17 Lite Announced with 6GB RAM

    • H3

      Sony Xperia XA1 Plus Launched with 23MP Camera for $379

    • H3

      Sony Launches Xperia XZ1 and XZ1 Compact with Snapdragon 835 SoC

    • H3

      Moto X4 Launched with Dual Rear Camera Setup

    • H3

      Nubia Z17 Lite Announced with 6GB RAM

    • H3

      Sony Xperia XA1 Plus Launched with 23MP Camera for $379

    • H3

      Sony Launches Xperia XZ1 and XZ1 Compact with Snapdragon 835 SoC

    • H3

      LG V30 Launched with Snapdragon 835 SoC

    • H3

      Intex Aqua Note 5.5 Launched with Android Nougat for Rs.5,799

    • H3

      Airtel New Broadband Plans with Increased Data at Same Price

    • H3

      BSNL Offers 270GB Data at Rs. 333 & More New Plans

    • H3

      BSNL Offers 300GB Data per Month with Free Night Calling

    • H3

      Best Samsung Galaxy Note 8 Features You Need to Know

    • H3

      Updated: Download Android Oreo Pixel Launcher apk Released

    • H3

      List of New Smartphones Not to get Android Oreo update

    • H3

      List of Android One Smartphones Not to Get Android Oreo Update

    • H3

      Lava Helium 14 Notebook Specifications and Price

    • H3

      How to Stay Safe Your System from Ransomware Attack

    • H3

      Asus Vivobook S Specifications and Price in US

    • H3

      How to Recover Permanently Deleted Files

    • H3

      How to Transfer Files between Computers Using LAN Cable

    • H3

      How to Downgrade iOS Apps to Old Versions

    • H3

      iVoomi Me4 and iVoomi Me5 Launched with 4G VoLTE

    • H3

      Best Big Screen Size Android Smartphones Under Rs.10,000

    • H3

      Jio Summer Surprise Offer may Ends Today

    • You are using h3 tags effectively
  19. H4 Tags

    • H4

      Mobile

    • H4

      Telecom News

    • H4

      STAY CONNECTED

    • H4

      Featured

    • H4

      PC

    • H4

      Special

    • You are using H4 tag effectively
  20. H5 Tags

    • You are not using h5 tags
  21. Your Page H Tag Structure

    H1


    1

    H2


    0

    H3


    35

    H4


    6

    H5


    0

    H6


    0


    Keep the H tag structure logical


  22. Good you are using Canonical url
  23. You are not using text attributes to highlight important content on your site. Try using them
  24. Good you are using Sitemap file
  25. You are not using robots.txt file. Use it to control who can access your site.
  26. Good you are using favicon
  27. Good, we found a blog on your site
  28. Your page loadtime is optimal. Good Work.
  29. Your website is W3C Validated, Excellent
  30. Your website is missing a rel='Publisher' tag for linking Google+ Page.
  31. Great, you are using meta viewport to configure other displays
  32. Your website is missing language meta tag, This tag is particularly useful for non-english and multiple language websites. Search engines which indexes websites on base of language read this tag.
  33. Good you are Open Graph Protocol

Things to do


  • Your website traffic is growing but can be expediated with targeted efforts.
  • Your facebook like requires immediate improvement.
  • Your Google Plus shares are very low, you are ignoring a gold mine.
  • Linkedin shares needs improvement. Use share buttons on your content.
  • Pinterest Shares are very low, Pinterest shares generate a lot of exposure and traffic.
  • Emphasize on your facebook promotion to receive more user inputs, appreciations and comments.
  • Very low stumble upon shares, add social sharing buttons on your site to increase your website exposure.
  • Title of your website needs improvement.
  • Description of your website needs improvement.
  • You can use your keyword tags more effectively.
  • H2 tag is not used effectively.
  • Use strong text attribute to highlight content on your page.
  • Use italics attributes on your page.
  • Use em attribute on your page.
  • Use bold attribute on your page.
  • Use acronym attribute on your page.
  • Use abbr attribute on your page. (for HTML5)
  • Use dfn (definition) tag on your page if appropriate.
  • Use Robots.txt file. Robots file works as a gatekeeper, use it for your benefit.
  • You are not using Language Meta.
  • Add rel='Publisher' tag for linking Google+ Page.

Common Todos


  • Set preferred domain (www/non www)
  • Remove Inline CSS
  • Keep text to html ration of atleast 2:1
  • Add Tweet Button
  • Add Facebook Share / Like Button
  • Add Google +1 button
  • Add an Apple Icon
  • Make sure website is responsive
  • Use Breadcrumb to display navigation structure with or without links
  • Use meaningful pagenames rich with keywords.

Your website needs immediate improvement

Secret Steps to Rank High Quick. For just $25.



Secret Steps + Implementation.