SEO Analysis of your site


Complete Detailed SEO Analysis

https://www.iogoos.com/

Analyzed on 2020-07-29 23:42:40

About this Analysis


This is a specially targeted analysis of your site https://www.iogoos.com/. It points out the most important aspects in terms of user experience as well as search engine exposure that needs attention to start getting traffic and retained visitors.
We have created our own algorithm to score your site. After reviewing thousands of websites in our algorithm, we have noticed that a site which scores 75 and above must be already receiving search engine traffic with good social exposure. If yoursite is anywhere below 75, you need to start acting immediately to improve your website promotion.

Your website Score

Links on your website

This area is usualy ignored but holds great importance as to how many internal and external links your website has. The niche of your business and the external links flowing out of your website determines the importance of those external websites as well as the niche of your website.


This pie chart will show you the ratio of internal and external links on your analyzed page.

Link Structure


The Observations


  1. Title
  2. IOGOOS Solution - A leading Digital Marketing Agency

    60% Complete

  3. Keywords


  4. Description

  5. Iogoos Solution is a digital marketing company in India, USA. Offering Website design services, mobile app development, SEO Services at affordable prices.


  6. Keywords in URL
  7. Excellent, keywords found in your URL



  8. Alt Tags
  9. You have 49 images without alt tags. out of 69 images on the page.
  10.  Alt tags needs immediate attention


  11. Facebook Likes
  12. You only have 0 Likes.Your facebook likes needs immediate improvement.


  13. Google Plus
  14. Your website is not shared on Google plus enough, they are only 0 , It is very crucial for ranking in google, make your content shareable, to speed up, join our social combo.


  15. Alexa Rank
  16. Your website Alexa Rank needs improvement, Its  276083 , The higher the Alexa Number, the lesser your site popularity.



  17. Keyword Density:
  18. Body Text Keyword cloud showing the most and least used keywords on the page.

    Below are the keywords which are prominently used in your webpage. Kindly review them to make sure you are not using unnecessary keywords not relevant to your business.

    This is very useful to get a bird eye on which keywords are most prominently used on your page. So that you are not diluting the keyword density on untargeted keywords.

    iogoos solution leading digital marketing agency phone email info website development services php cakephp cms devlopment service wordpress drupal angular joomla laravel real estate design shopify india hospital management software hubspot featured award winning company highly skilled web developers team helping customer oriented frontiers delivering fully functional user friendly business app offers complete develop unique content system manage data information theme custom modules creation ensuring smooth function automation mobile android developmnet ios apps windows native phonegap ionic improve performance creative provide enterprises making critical decisions certified ensures affordable years experience iphone field pay click social media paid advertising search engine optimization seo pricing personalities promoting leaders online presence obligatory attaining success today clients increase organic traffic average retention rate months high optimizations position showing consumers graphic logo psd xhtml designing faq virtual employee ecommerce research erp crm portfolio blog contact angularjs epr html stop explore cross platform create revenue smo ppc successfully delivered thousands applications startups small medium top brands empowering intelligence expertise deliver outcomes fsater competitors earn millions dollars simple strategies systems cloud project managment strategic consulting maintenance support market busines established experienced innovative ideas cutting edge responsive websites augmented reality simplify effective details strictly focus quality productions proven track record providing technology worldwide recognizes performing partner proud part community gold check profile case studies reviews growth stack start discuss react progressive dev commerce product wireframing protyping read people choose credibility flexibility security dedicated manager employees aroud glob plug world class strategy behoneybee destination cuts clothing closetcandy trendy women boutique book house maid working spare time life angelas bridal fall love exquisite gown collections chopra center hands view measurable results satisfied businesses testimonial wanted urgent posted requirement freelancer proposal recommend amazing cost finally deadline result satisfying lyra bellaqwa fashion designer achieve goal engagement boosted generate sales leads rankings targeted keywords ranking page generated increased improvement brand reputation communicators respond quickly sweta sharma global pageant ceo initially hired optimize pages higher conversion rates lead produce posts viral continued constant process smithery founder worked find internet marketer aspect steps give great don provider jhon smith customers projects talk country afghanistanalbaniaalgeriaamerican samoaandorraangolaanguillaantarcticaantigua barbudaargentinaarmeniaarubaaustraliaaustriaazerbaijanbahamasbahrainbangladeshbarbadosbelarusbelgiumbelizebeninbermudabhutanboliviabosnia herzegovinabotswanabouvet islandbrazilbritish indian ocean territorybrunei darussalambulgariaburkina fasoburundicambodiacamerooncanadacape verdecayman islandscentral african republicchadchilechinachristmas islandcocos keeling islandscolombiacomoroscongocongo democratic republic thecook islandscosta ricacote ivoirecroatiacubacyprusczech republicdenmarkdjiboutidominicadominican republicecuadoregyptel salvadorequatorial guineaeritreaestoniaethiopiafalkland islands malvinas faroe islandsfijifinlandfrancefrench guianafrench polynesiafrench southern territoriesgabongambiageorgiagermanyghanagibraltargreecegreenlandgrenadaguadeloupeguamguatemalaguineaguinea bissauguyanahaitiheard island mcdonald islandsholy vatican city state hondurashong konghungaryicelandindiaindonesiairan islamic ofiraqirelandisraelitalyjamaicajapanjordankazakhstankenyakiribatikorea ofkorea ofkuwaitkyrgyzstanlao republiclatvialebanonlesotholiberialibyan arab jamahiriyaliechtensteinlithuanialuxembourgmacaomacedonia yugoslav ofmadagascarmalawimalaysiamaldivesmalimaltamarshall islandsmartiniquemauritaniamauritiusmayottemexicomicronesia federated states ofmoldova ofmonacomongoliamontserratmoroccomozambiquemyanmarnamibianaurunepalnetherlandsnetherlands antillesnew caledonianew zealandnicaraguanigernigerianiuenorfolk islandnorthern mariana islandsnorwayomanpakistanpalaupalestinian territory occupiedpanamapapua guineaparaguayperuphilippinespitcairnpolandportugalpuerto ricoqatarreunionromaniarussian federationrwandasaint helenasaint kitts nevissaint luciasaint pierre miquelonsaint vincent grenadinessamoasan marinosao tome principesaudi arabiasenegalserbia montenegroseychellessierra leonesingaporeslovakiasloveniasolomon islandssomaliasouth africasouth georgia south sandwich islandsspainsri lankasudansurinamesvalbard jan mayenswazilandswedenswitzerlandsyrian republictaiwan province chinatajikistantanzania united ofthailandtimor lestetogotokelautongatrinidad tobagotunisiaturkeyturkmenistanturks caicos islandstuvaluugandaukraineunited emiratesunited kingdomunited statesunited minor outlying islandsuruguayuzbekistanvanuatuvenezuelaviet namvirgin britishvirgin wallis futunawestern saharayemenzambiazimbabwe budget july comments category hire launch evolved influential accessible platforms algorithm frie popular news codeigniter april quote request application flash prasentation cryptocurrency trading professional offshore outsourcing english promotion campaign sms desktop hosting domain registration expert copyright rights reserved graphics estimation asap weeks takes

  19. Keyphrase found on your page.

  20. Single Keywords


    development, services, website, iogoos, marketing, solution, app, design, web, mobile, republic, digital, media, software, social, apps, business, company, explore, content, android, virtual, developmnet, result, search,

    2 Keywords Phrase


    development services,
    iogoos solution,
    website development,
    app development,
    digital marketing,
    mobile app,
    social media,
    marketing services,
    apps development,

    3 Keywords Phrase


    digital marketing services,
    website development services,
    social media marketing,
    development iogoos solution,
    services enterprises making,
    enterprises making critical,
    marketing social media,
    virtual employee services,
    website designing services,


  21. OnPage Links
  22. There are total 185 backlinks found on your page out of which 1 are external links

    There are total 8 links without anchor text

    184 Internal Links

    35% Complete (success)

    1 External Links

    20% Complete (warning)
  23. H1 Tags
  24. H1

    About Us

  25. H1

    4.9 / 5.0

  26. You are not using H1 tags effectively Content used in the h1 are relevant to the page


  27. H2 Tags
  28. H2

    Custom Software Development

  29. H2

    We provide Services for all Enterprises in making critical busines decisions.

  30. H2

    We provide Services for all Enterprises in making critical busines decisions.

  31. H2

    Why People Choose Us

  32. H2

    Portfolio

  33. H2

    ONE STOP DESTINATION FOR ALL YOUR NEEDS!

  34. H2

    ONE STOP DESTINATION FOR ALL YOUR NEEDS!

  35. H2

    TRENDY WOMEN'S BOUTIQUE

  36. H2

    STOP WORKING,SPARE SOME TIME FOR REAL LIFE.

  37. H2

    FALL IN LOVE WITH OUR EXQUISITE BRIDAL GOWN COLLECTIONS

  38. H2

    TAKE YOUR WELL-BEING INTO YOUR OWN HANDS

  39. H2

    Delivering measurable results for our 450+ satisfied world's leading businesses

  40. H2

    Testimonial

  41. H2

    Let Start Talk

  42. H2

    Blog

  43. H2

    Why must you hire a Shopify Development Company in 2020?

  44. H2

    Testimonial

  45. You are using H2 effectively Content used in the H2 are relevant to the page


  46. H3 Tags
  47. H3

    Hubspot recognizes IOGOOS SOLUTION as a top performing partner agency in

  48. H3

    in

  49. H3

    App Development

  50. H3

    Web Development

  51. H3

    UI/ UX Design

  52. H3

    Credibility

  53. H3

    Flexibility

  54. H3

    Security

  55. H3

    Value

  56. H3

    Support

  57. H3

    Dedicated Project Manager

  58. H3

    80+ Employees

  59. H3

    Clients From Aroud The Glob

  60. H3

    Web Design & Development

  61. H3

    About IOGOOS SOLUTION

  62. H3

    Internet Marketing

  63. H3

    Web Hosting

  64. H3

    Get A Quote

  65. You are using h3 tags effectively

  66. H4 Tags
  67. H4

    What Can we Do for you ?

  68. H4

    Why must you hire a Shopify Development Company in 2020?

  69. H4

    Why choose Laravel Development Company instead of Codeigniter in 2020?

  70. H4

    HIRE VIRTUAL EMPLOYEE WITH IOGOOS SOLUTION

  71. H4

    Why choose Top Virtual Employee Services for your business?

  72. You are using H4 tag effectively

  73. H5 Tags
  74. H5

    Website Development Services

  75. H5

    Mobile App Development Services

  76. H5

    Digital Marketing Services

  77. H5

    UI/UX Design

  78. H5

    Popular News

  79. You are using H5 tag effectively

  80. H6 Tags
  81. H6

  82. You are using H6 tag effectively


  83. Your Page H Tag Structure

    H1


    2

    H2


    17

    H3


    18

    H4


    5

    H5


    5

    H6


    1


    Keep the H tag structure logical


  84. Good you are using Canonical url
  85. Its good you are using text attributes to highlight important content.
  86. Good you are using Sitemap file
  87. You are not using robots.txt file. Use it to control who can access your site.
  88. Good you are using favicon
  89. Good, we found a blog on your site
  90. Your page loadtime is optimal. Good Work.
  91. Your website is W3C Validated, Excellent
  92. Your website is missing a rel='Publisher' tag for linking Google+ Page.
  93. Great, you are using meta viewport to configure other displays
  94. Your website is missing language meta tag, This tag is particularly useful for non-english and multiple language websites. Search engines which indexes websites on base of language read this tag.
  95. Good you are Open Graph Protocol

Things to do


  • Your website traffic is growing but can be expediated with targeted efforts.
  • Your facebook like requires immediate improvement.
  • Your Google Plus shares are very low, you are ignoring a gold mine.
  • Linkedin shares needs improvement. Use share buttons on your content.
  • Pinterest Shares are very low, Pinterest shares generate a lot of exposure and traffic.
  • Emphasize on your facebook promotion to receive more user inputs, appreciations and comments.
  • Title of your website needs improvement.
  • Description of your website needs improvement.
  • You can use your keyword tags more effectively.
  • Your images needs relevant alt tags with targeted keywords.
  • Use italics attributes on your page.
  • Use em attribute on your page.
  • Use bold attribute on your page.
  • Use acronym attribute on your page.
  • Use abbr attribute on your page. (for HTML5)
  • Use dfn (definition) tag on your page if appropriate.
  • Use Robots.txt file. Robots file works as a gatekeeper, use it for your benefit.
  • You are not using Language Meta.
  • Add rel='Publisher' tag for linking Google+ Page.

Common Todos


  • Set preferred domain (www/non www)
  • Remove Inline CSS
  • Keep text to html ration of atleast 2:1
  • Add Tweet Button
  • Add Facebook Share / Like Button
  • Add Google +1 button
  • Add an Apple Icon
  • Make sure website is responsive
  • Use Breadcrumb to display navigation structure with or without links
  • Use meaningful pagenames rich with keywords.

Your website needs immediate improvement

Order site fix and improvement for a discount today below